PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000302984
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 794aa    MW: 90053.9 Da    PI: 6.7056
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000302984genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l +++++ G g+W++ ++  g++R++k+c++rw +yl
    MDP0000302984 14 KGPWTPEEDQKLMKYIQKNGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding53.36.4e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ +++++  lG++ W++Ia +++ gRt++++k++w+++l
    MDP0000302984  67 RGKFSQEEEQTILNLHSILGNK-WSAIAGHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-25564IPR009057Homeodomain-like
PROSITE profilePS5129418.349961IPR017930Myb domain
SuperFamilySSF466893.11E-3111108IPR009057Homeodomain-like
SMARTSM007172.5E-141363IPR001005SANT/Myb domain
PfamPF002491.3E-161461IPR001005SANT/Myb domain
CDDcd001671.34E-101661No hitNo description
PROSITE profilePS5129426.44262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-2765117IPR009057Homeodomain-like
SMARTSM007172.7E-1666114IPR001005SANT/Myb domain
PfamPF002491.9E-1567112IPR001005SANT/Myb domain
CDDcd001672.03E-1169112No hitNo description
PfamPF105517.9E-18564659IPR018289MULE transposase domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 794 aa     Download sequence    Send to blast
MGRSPCCDES GLKKGPWTPE EDQKLMKYIQ KNGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SQEEEQTILN LHSILGNKWS AIAGHLPGRT DNEIKNFWNT HLKKKLIQMG  120
FDPMTHRPRT DIFSSLPHLL ALVNLKELLD HGSSHQSCWD EQALRLQAEA SQMAXLQYLQ  180
CLLQPNNNSF GAATPNNLND FIDMETFNLL NXLGSSQLDI QDPTAQYPVG DFQPVVQDNS  240
VPFSHLPDLQ TYPTPPNKDM VNDQAPDQFT ALSQGENSPN NPWNIPSSSN TTLSPTSVAP  300
PMTVTETSNS FREFFNFFRI WLSGLSNACR RMLRAHFEIV IAVVLRPFXE NGKLARFTYG  360
GLCVICSDLC SRFKGLRVGC FELRYALNEN PNCVXDYDAD VLNMFMVLNI VGKSIVEILV  420
MDKCDGSMVQ LPXESTSSCX TSDXMVVASE NDHLRKYGSH GVHNFMLCEW DSYIEFEGQV  480
FRGGCIDFRD KLKKFSVECG FELKAVFELN GDAIDAYKFL PWYVEFARSS NPGSVVELKV  540
VPESNRLFIA YDAWIKGLMF CRSILFIDGT FIKSKYKGTL LSCCVKNGND EIFEVTYAIV  600
DSXTIANXRW FFAILSGILR PXGKVITFMS DKHDGILKSI REFFPECPHS FCIVHLKQNV  660
STLFPKAAGE GLKKKMMNLM ANCAHACTPS DFDDCMXEFK DNEQGHVKNF LCDXPKENYA  720
IAHFPGKRWG SMSNVFSESF NAMVSNSRCM PLLDLLKDIR VXLMGSMAEK RILVLQQDNC  780
DVFYYVDDYW KASF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-30121165108B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.14e-99myb domain protein 93